General Information

  • ID:  hor001108
  • Uniprot ID:  Q2HWR1
  • Protein name:  RFamide
  • Gene name:  PQRFa
  • Organism:  Petromyzon marinus (Sea lamprey)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Petromyzon (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  SWGAPAEKFWMRAMPQRF
  • Length:  18
  • Propeptide:  MEAKAVSAMLLLALANCVLVSAARGSFSSMEEAAMPDSDSSLTKDYLAESVHEDPYRDSFDRASPDAAGSSSSEQLLLSRLARAFMHFPQRFGRAGPSSLFQPQRFGRGSNDDEEVPPSLFYRRSWGAPAEKFWMRAMPQRFGRKK
  • Signal peptide:  MEAKAVSAMLLLALANCVLVSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in neuroendocrine and behavioral functions.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q2HWR1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001108_AF2.pdbhor001108_ESM.pdb

Physical Information

Mass: 249997 Formula: C102H146N28O23S2
Absent amino acids: CDHILNTVY Common amino acids: A
pI: 11.48 Basic residues: 3
Polar residues: 2 Hydrophobic residues: 7
Hydrophobicity: -62.78 Boman Index: -2945
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 16.67
Instability Index: 6444.44 Extinction Coefficient cystines: 11000
Absorbance 280nm: 647.06

Literature

  • PubMed ID:  16623709
  • Title:  Evolutionary Origin and Divergence of PQRFamide Peptides and LPXRFamide Peptides in the RFamide Peptide Family. Insights From Novel Lamprey RFamide Peptides